PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G23190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 375aa    MW: 39401.4 Da    PI: 6.8597
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G23190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box217.1e-075398342
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      ++C+ +e  ++   C+ +   lC+ C   +H        H +vp+
  OMERI06G23190.1 53 VWVCEVCEVAPAAVTCKADAAVLCAACDADIHDAnplarrHARVPV 98
                     689*****************************44677777888775 PP

2CCT70.34.8e-24299342144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  OMERI06G23190.1 299 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRA 342
                      9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.11050IPR000315B-box-type zinc finger
SMARTSM003366.0E-135198IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3815198IPR000315B-box-type zinc finger
CDDcd000214.25E-75498No hitNo description
PROSITE profilePS5101716.896299341IPR010402CCT domain
PfamPF062038.6E-18299341IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MMELRKYWGV GGRRCGACEA SPAAVHCRGC GGVYLCTACD ARPGHARAAH ERVWVCEVCE  60
VAPAAVTCKA DAAVLCAACD ADIHDANPLA RRHARVPVAP IGSAAAAAVA AEAMLFGVAA  120
AGAEAEAVVE KAAAEHHHHQ QRQQHGALNL NVEAKDMKLD YLFSDLDPYL NVEFARFPHA  180
DSVVPNGAGA GAAIELDFTC GLGVGVGGAK QSYSSYTATD LAHSGSSSEV GVVPEAMCGG  240
GGGGGGAIDL DFTRPKPQPY MPYTATPPPS HSVVSAQMSS SVVDVGVVPE RAAAMGQGRE  300
ARLMRYREKR KNRRFEKTIR YASRKAYAET RPRIKGRFAK RADHDADDAD ADADDPAAVP  360
SSYMLDFGYG VVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4066130.0CU406613.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C109H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641209.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0E0E4L20.0A0A0E0E4L2_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g44450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-20CONSTANS-like 2